Recombinant Human Syndecan-4 (SDC4), partial | CSB-EP327046HU

Recombinant Human Syndecan-4 (SDC4), partial | CSB-EP327046HU | Cusabio

Alternative Name(s): Amphiglycan Ryudocan core protein

Gene Names: SDC4

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 19-145aa

Sequence Info: Extracellular Domain

MW: 29.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cell surface proteoglycan that bears heparan sulfate.

Reference: "Molecular cloning of amphiglycan, a novel integral membrane heparan sulfate proteoglycan expressed by epithelial and fibroblastic cells." David G., van der Schueren B., Marynen P., Cassiman J.-J., van den Berghe H.J. Cell Biol. 118:961-969(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cell surface proteoglycan that bears heparan sulfate. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP

Involvement in disease:

Subcellular Location: Isoform 1: Membrane, Single-pass type I membrane protein, Secreted

Protein Families: Syndecan proteoglycan family

Tissue Specificity: Expressed in epithelial and fibroblastic cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P31431

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM