Recombinant Human Syndecan-2 (SDC2), partial (Active) | CSB-AP005481HU

(No reviews yet) Write a Review
SKU:
CSB-AP005481HU
Availability:
5 to 10 Working Days
  • Recombinant Human Syndecan-2 (SDC2) ,partial (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€188.00 - €363.00

Description

Recombinant Human Syndecan-2 (SDC2) ,partial (Active) | CSB-AP005481HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Syndecan-2; SYND2; Fibroglycan; Heparan Sulfate Proteoglycan Core Protein; HSPG; CD362; SDC2; HSPG1

Gene Names: SDC2

Research Areas: Signal Transduction

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal 6xHis-tagged

Expression Region: 19-144aa

Sequence Info: ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE

Biological Activity: The ED50 as determined by its ability to bind Human FGFb in functional ELISA is less than 5 ug/ml.

MW: 14.98 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Syndecan-2 is a member of the Syndecans family comprised of type I transmembrane heparan sulfate proteoglycans (HSPG) that are involved in the regulation of many cellular processes. Four sub-types of mammalian Syndecans have been reported and among them. Syndecan-2 plays a role in the cancer development. It can affect the basal and chemotherapy-induced apoptosis in osteosarcoma. It can also suppress MMP2 activation, suppressing metastasis.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis (By similarity) .

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families: Syndecan proteoglycan family

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm Filtered 20 mM Tris-Citrate, 150 mM NaCl, pH 7.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P34741

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose