Recombinant Human Sperm mitochondrial-associated cysteine-rich protein (SMCP) | CSB-EP021820HU

Recombinant Human Sperm mitochondrial-associated cysteine-rich protein (SMCP) | CSB-EP021820HU | Cusabio

Alternative Name(s): HSMCSGEN1 ; MCS ; MCSP ; MCSP_HUMAN; Mitochondrial capsule selenoprotein; SMCP; Sperm mitochondria associated cysteine rich protein; Sperm mitochondrial-associated cysteine-rich protein

Gene Names: SMCP

Research Areas: Developmental Biology

Organism: Homo sapiens (Human)

AA Sequence: MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-116aa

Sequence Info: Full Length

MW: 39.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the fale reproductive tract and inability to penetrate the oocyte zona pellucida .

Reference: Isolation, expression, and chromosomal localization of the human mitochondrial capsule selenoprotein gene (MCSP).Aho H., Schwemmer M., Tessmann D., Murphy D., Mattei M.-G., Engel W., Adham I.M.Genomics 32:184-190(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the female reproductive tract and inability to penetrate the oocyte zona pellucida (By similarity).

Involvement in disease:

Subcellular Location: Cytoplasm, Mitochondrion membrane, Peripheral membrane protein, Cytoplasmic side

Protein Families:

Tissue Specificity: Testis. Is selectively expressed in the spermatids of seminiferous tubules.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P49901

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM