Recombinant Human Sperm-egg fusion protein Juno (IZUMO1R) | CSB-EP008789HUb0

(No reviews yet) Write a Review
SKU:
CSB-EP008789HUb0
Availability:
13 - 23 Working Days
$294.00 - $1,532.40

Description

Recombinant Human Sperm-egg fusion protein Juno (IZUMO1R) | CSB-EP008789HUb0 | Cusabio

Alternative Name(s): Folate receptor 4 (Folate receptor delta) (FR-delta) (IZUMO1 receptor protein JUNO) (FOLR4) (JUNO)

Gene Names: IZUMO1R

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 20-250aa

Sequence Info: Full Length of Mature Protein

MW: 32.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Receptor for IZUMO1 present at the cell surface of oocytes, which is essential for species-specific gamete recognition and fertilization. The IZUMO1:IZUMO1R/JUNO interaction is a necessary adhesion event between sperm and egg that is required for fertilization but is not sufficient for cell fusion. The ligand-receptor interaction probably does not act as a membrane 'fusogen'. Does not bind folate.

Reference: "A glycan-phosphatidylinositol-specific phospholipase D in human serum." Davitz M.A., Hereld D., Shak S., Krakow J., Englund P.T., Nussenzweig V. Science 238:81-84(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: A6ND01

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose