Recombinant Human SIN3-HDAC complex-associated factor (SINHCAF) (Active) | CSB-EP882059HUe0

(No reviews yet) Write a Review
SKU:
CSB-EP882059HUe0
Availability:
13 to 23 Working Days
  • Recombinant Human SIN3-HDAC complex-associated factor (SINHCAF) (Active)
  • Recombinant Human SIN3-HDAC complex-associated factor (SINHCAF) (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Human SIN3-HDAC complex-associated factor (SINHCAF) (Active) | CSB-EP882059HUe0 | Cusabio

Protein Description: Full Length

Alternative Name (s) : Protein FAM60A (Tera protein homolog) (C12orf14) (FAM60A)

Gene Names: SINHCAF

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-221aa

Sequence Info: MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 μg/ml can bind human SINHCAF, the EC50 of human SINHCAF protein is 31.54-38.59 μg/ml.

MW: 51.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test.

Relevance: Subunit of the Sin3 deacetylase complex, this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway . Core component of a SIN3A complex present in embryonic stem cells. Promotes the stability of SIN3A and its presence on chromatin and is essential for maintaining the potential of ES cells to proliferate rapidly, while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9NP50

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose