Recombinant Human Leukemia inhibitory factor (LIF) (Active) | CSB-MP012928HUd9

(No reviews yet) Write a Review
SKU:
CSB-MP012928HUd9
Availability:
3 to 7 Working Days
  • Recombinant Human Leukemia inhibitory factor (LIF) (Active)
  • Recombinant Human Leukemia inhibitory factor (LIF) (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€209.00 - €339.00

Description

Recombinant Human Leukemia inhibitory factor (LIF) (Active) | CSB-MP012928HUd9 | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) :

Gene Names: LIF

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal hFc-tagged

Expression Region: 23-202aa

Sequence Info: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human LIF at 2 μg/ml can bind human LIFR (CSB-MP012929HUi9) , the EC50 is 22.58-30.24 ng/ml.

MW: 48.6

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance:

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P15018

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose