Recombinant Human Serpin B9 (SERPINB9) | CSB-EP021077HU

Recombinant Human Serpin B9 (SERPINB9) | CSB-EP021077HU | Cusabio

Alternative Name(s): Cytoplasmic antiproteinase 3

Gene Names: SERPINB9

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-376aa

Sequence Info: Full Length

MW: 69.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Granzyme B inhibitor.

Reference: "Serine proteinase inhibitor 9 as a tumor antigen recognized by cytotoxic T lymphocytes of epithelial cancer patients." Tanaka K., Harashima N., Shichijo S., Harada M., Itoh K. Submitted (APR-2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Granzyme B inhibitor.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Serpin family, Ov-serpin subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P50453

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM