Recombinant Human Serine protease inhibitor Kazal-type 1 (SPINK1), partial | CSB-EP022575HU1

Recombinant Human Serine protease inhibitor Kazal-type 1 (SPINK1), partial | CSB-EP022575HU1 | Cusabio

Alternative Name(s): Pancreatic secretory trypsin inhibitor;Tumor-associated trypsin inhibitor;TATI

Gene Names: SPINK1

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: GNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Source: E.coli

Tag Info: N-terminal 6xHis-GST-tagged

Expression Region: 19-79aa

Sequence Info: Partial

MW: 38.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Serine protease inhibitor which exhibits anti-trypsin activity (PubMed:7142173). In the pancreas, protects against trypsin-catalyzed premature activation of zymogens. In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production.

Reference: "Purification and characterization of a tumor-associated trypsin inhibitor from the urine of a patient with ovarian cancer." Huhtala M.-L., Pesonen K., Kalkkinen N., Stenman U.-H. J. Biol. Chem. 257:13713-13716(1982)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P00995

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A