Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1) | CSB-YP362579MO

(No reviews yet) Write a Review
SKU:
CSB-YP362579MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,135.00

Description

Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1) | CSB-YP362579MO | Cusabio

Alternative Name(s): P12;Prostatic secretory glycoprotein

Gene Names: Spink1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-80aa

Sequence Info: Full Length of Mature Protein

MW: 8.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Serine protease inhibitor which exhibits anti-trypsin activity. Inhibits the uptake of calcium by spermatozoa.

Reference: A secretory protease inhibitor requires androgens for its expression in male sex accessory tissues but is expressed constitutively in pancreas.Mills J.S., Needham M., Parker M.G.EMBO J. 6:3711-3717(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Serine protease inhibitor which exhibits anti-trypsin activity

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity: In the genital tract, expressed only in male accessory glands including seminal vesicle, coagulating gland and prostate.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P09036

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose