Recombinant Human Secreted Ly-6/uPAR-related protein 1 (SLURP1) | CSB-EP021784HUe1

(No reviews yet) Write a Review
SKU:
CSB-EP021784HUe1
Availability:
13 - 23 Working Days
  • Recombinant Human Secreted Ly-6/uPAR-related protein 1 (SLURP1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$487.20 - $2,172.00

Description

Recombinant Human Secreted Ly-6/uPAR-related protein 1 (SLURP1) | CSB-EP021784HUe1 | Cusabio

Alternative Name(s): ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein

Gene Names: SLURP1

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL

Source: E.coli

Tag Info: Tag-Free

Expression Region: 23-103aa

Sequence Info: Full Length of Mature Protein

MW: 8.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin. In vitro down-regulates keratinocyte proliferation; the function may involve the proposed role as modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-7-dependent nAChR currents in an allosteric manner. In T cells may be involved in regulation of intracellular Ca2+ signaling. Seems to have a immunomodulatory function in the cornea. The function may implicate a possible role as a scavenger receptor for PLAU thereby blocking PLAU-dependent functions of PLAUR such as in cell migration and proliferation

Reference: "Partial N-terminal amino acid sequence of the anti-neoplastic urinary protein (ANUP) and the anti-tumour effect of the N-terminal nonapeptide of the unique cytokine present in human granulocytes." Ridge R.J., Sloane N.H. Cytokine 8:1-5(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has an antitumor activity

Involvement in disease: Mal de Meleda (MDM)

Subcellular Location: Secreted

Protein Families:

Tissue Specificity: Granulocytes. Expressed in skin. Predominantly expressed in the granular layer of skin, notably the acrosyringium. Identified in several biological fluids such as sweat, saliva, tears, plasma and urine.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55000

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose