Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2) | CSB-YP861187HU2

(No reviews yet) Write a Review
SKU:
CSB-YP861187HU2
Availability:
3 - 7 Working Days
  • Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€339.00 - €551.00

Description

Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2) | CSB-YP861187HU2 | Cusabio

Alternative Name(s): Secreted LY6/PLAUR domain-containing protein 2 Secreted Ly-6/uPAR-related protein 2

Gene Names: SLURP2

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 23-97aa

Sequence Info: Full Length of Mature Protein

MW: 10 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds and may modulate the functional properties of nicotinic and muscarinic acetylcholine receptors. May regulate keratinocytes proliferation, differentiation and apoptosis. In vitro moderately inhibits ACh-evoked currents of alpha-3:beta-2-containing nAChRs and strongly these of alpha-4:beta-2-containing nAChRs, modulates alpha-7-containing nAChRs, and inhibits nicotine-induced signaling probably implicating alpha-3:beta-4-containing nAChRs. Proposed to act on alpha-3:beta-2 and alpha-7 nAChRs in an orthosteric, and on mAChRs, such as CHRM1 and CHRM3, in an allosteric manner.

Reference: "SLURP-2, a novel member of the human Ly-6 superfamily that is up-regulated in psoriasis vulgaris." Tsuji H., Okamoto K., Matsuzaka Y., Iizuka H., Tamiya G., Inoko H. Genomics 81:26-33(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds and may modulate the functional properties of nicotinic and muscarinic acetylcholine receptors. May regulate keratinocytes proliferation, differentiation and apoptosis. In vitro moderately inhibits ACh-evoked currents of alpha-3

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity: Expressed at highest levels in cervix and esophagus, followed by adult and fetal skin. Expressed at lower levels in brain, lung, stomach, small intestine, colon, rectum, uterus, and thymus. Not detected in spleen nor bone marrow. Up-regulated 3-fold in psoriatic lesional skin (PubMed:12573258). In the epidermis, predominantly produced by keratinocytes of the suprabasal epidermal compartment (at protein level) (PubMed:16575903). In attached gingiva, produced at highest levels by basal cells located in the lowermost epithelial layers (at protein level) (PubMed:16575903). Detected in serum (at protein level) (PubMed:16575903).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0DP57

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose