Recombinant Human Pulmonary surfactant-associated protein A1 (SFTPA1) | CSB-CF810281HU

(No reviews yet) Write a Review
SKU:
CSB-CF810281HU
Availability:
18 - 23 Working Days
  • Recombinant Human Pulmonary surfactant-associated protein A1 (SFTPA1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£515.20 - £721.60

Description

Recombinant Human Pulmonary surfactant-associated protein A1 (SFTPA1) | CSB-CF810281HU | Cusabio

Alternative Name(s): Collectin-4

Gene Names: SFTPA1

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Expression Region: 21-248aa

Sequence Info: Full Length of Mature Protein

MW: 41.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration.

Reference: "Isolation and characterization of the human pulmonary surfactant apoprotein gene."White R.T., Damm D., Miller J., Spratt K., Schilling J., Hawgood S., Benson B., Cordell B.Nature 317:361-363(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages (By similarity).

Involvement in disease: Pulmonary fibrosis, idiopathic (IPF); Respiratory distress syndrome in premature infants (RDS)

Subcellular Location: Secreted, extracellular space, extracellular matrix, Secreted, extracellular space, surface film

Protein Families: SFTPA family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8IWL2

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose