Recombinant Human Pulmonary surfactant-associated protein A1 (SFTPA1) | CSB-YP810281HU

Recombinant Human Pulmonary surfactant-associated protein A1 (SFTPA1) | CSB-YP810281HU | Cusabio

Alternative Name(s): 35 kDa pulmonary surfactant-associated protein Alveolar proteinosis protein Collectin-4 COLEC4, PSAP, SFTP1, SFTPA, SFTPA1B

Gene Names: SFTPA1

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 21-248aa

Sequence Info: Full Length of Mature Protein

MW: 26.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages. (Microbial infection) Recognition of M.tuberculosis by dendritic cells may occur partially via this molecule. Can recognize, bind, and opsonize pathogens to enhance their elimination by alveolar macrophages

Reference: "Isolation and characterization of cDNA clones for the 35-kDa pulmonary surfactant-associated protein." Floros J., Steinbrink R., Jacobs K., Phelps D., Kriz R., Recny M., Sultzman L., Jones S., Taeusch H.W., Frank H.A., Fritsch E.F. J. Biol. Chem. 261:9029-9033(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages (By similarity).

Involvement in disease: Pulmonary fibrosis, idiopathic (IPF); Respiratory distress syndrome in premature infants (RDS)

Subcellular Location: Secreted, extracellular space, extracellular matrix, Secreted, extracellular space, surface film

Protein Families: SFTPA family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8IWL2

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM