Recombinant Human Protein yippee-like 3 (YPEL3) | CSB-EP026272HU

Recombinant Human Protein yippee-like 3 (YPEL3) | CSB-EP026272HU | Cusabio

Alternative Name(s): Protein yippee-like 3; Small ubiquitinated apoptotic protein; Yippee like 3; Yippee-like 3 (Drosophila); Ypel3; YPEL3_HUMAN

Gene Names: YPEL3

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-119aa

Sequence Info: Full Length

MW: 29.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in proliferation and apoptosis in myeloid precursor cells.

Reference: Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species.Hosono K., Sasaki T., Minoshima S., Shimizu N.Gene 340:31-43(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in proliferation and apoptosis in myeloid precursor cells.

Involvement in disease:

Subcellular Location: Nucleus, nucleolus

Protein Families: Yippee family

Tissue Specificity: Widely expressed.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P61236

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM