Recombinant Human Calmodulin-like protein 3 (CALML3) | CSB-EP004453HU

Recombinant Human Calmodulin-like protein 3 (CALML3) | CSB-EP004453HU | Cusabio

Alternative Name(s): CaM-like protein

Gene Names: CALML3

Research Areas: Tags & Cell Markers

Organism: Homo sapiens (Human)

AA Sequence: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-149aa

Sequence Info: Full Length

MW: 43.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.

Reference: "Down-regulation of a calmodulin-related gene during transformation of human mammary epithelial cells." Yaswen P., Smoll A., Peehl D.M., Trask D.K., Sager R., Stampfer M.R. Proc. Natl. Acad. Sci. U.S.A. 87:7360-7364(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.

Involvement in disease:

Subcellular Location:

Protein Families: Calmodulin family

Tissue Specificity: Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells.

Paythway: Calciumsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P27482

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM