Recombinant Human Protein-lysine 6-oxidase (LOX), partial | CSB-RP169094h

(No reviews yet) Write a Review
SKU:
CSB-RP169094h
Availability:
3 - 7 Working Days
  • Recombinant Human Protein-lysine 6-oxidase (LOX), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Protein-lysine 6-oxidase (LOX), partial | CSB-RP169094h | Cusabio

Alternative Name(s): Lysyl oxidase

Gene Names: LOX

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: PYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 174-417aa

Sequence Info: Partial

MW: 32.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. In addition to cross-linking of Extracellular domain matrix proteins, may have a direct role in tumor suppression.

Reference: Molecular cloning of human lysyl oxidase and assignment of the gene to chromosome 5q23.3-31.2.Haemaelaeinen E.-R., Jones T.A., Sheer D., Taskinen K., Pihlajaniemi T., Kivirikko K.I.Genomics 11:508-516(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin

Involvement in disease: Aortic aneurysm, familial thoracic 10 (AAT10)

Subcellular Location: Secreted, Secreted, extracellular space

Protein Families: Lysyl oxidase family

Tissue Specificity: Heart, placenta, skeletal muscle, kidney, lung and pancreas.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P28300

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose