Recombinant Human Protein-lysine 6-oxidase (LOX) | CSB-BP013038HU

(No reviews yet) Write a Review
SKU:
CSB-BP013038HU
Availability:
3 - 7 Working Days
  • Recombinant Human Protein-lysine 6-oxidase (LOX)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€328.00 - €740.00

Description

Recombinant Human Protein-lysine 6-oxidase (LOX) | CSB-BP013038HU | Cusabio

Alternative Name(s): Lysyl oxidase

Gene Names: LOX

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Source: Baculovirus

Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-tagged

Expression Region: 169-417aa

Sequence Info: Full Length of Mature Protein

MW: 73 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin (PubMed:26838787). Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture

Reference: "Characterization of microfibrillar-associated protein 4 (MFAP4) as a tropoelastin- and fibrillin-binding protein involved in elastic fiber formation." Pilecki B., Holm A.T., Schlosser A., Moeller J.B., Wohl A.P., Zuk A.V., Heumueller S.E., Wallis R., Moestrup S.K., Sengle G., Holmskov U., Sorensen G.L. J. Biol. Chem. 291:1103-1114(2016)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin

Involvement in disease: Aortic aneurysm, familial thoracic 10 (AAT10)

Subcellular Location: Secreted, Secreted, extracellular space

Protein Families: Lysyl oxidase family

Tissue Specificity: Heart, placenta, skeletal muscle, kidney, lung and pancreas.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P28300

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose