Recombinant Human Prolactin receptor (PRLR) | CSB-CF018727HU

(No reviews yet) Write a Review
SKU:
CSB-CF018727HU
Availability:
18 - 23 Working Days
  • Recombinant Human Prolactin receptor (PRLR)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$2,082.00 - $3,129.60

Description

Recombinant Human Prolactin receptor (PRLR) | CSB-CF018727HU | Cusabio

Alternative Name(s): AI987712; CLONE SPM213; CPRLP; Delta 4-delta 7/11 truncated prolactin receptor ; Delta 4-SF1b truncated prolactin receptor ; HPRL; hPRL receptor; hPRLrI; Lactogen receptor; MFAB; MGC105486; OPR; OTTHUMP00000115998 ; Pr-1; Pr-3; PRL R; PRL-R; PRLR; Prlr-rs1; PRLR_HUMAN; Prolactin receptor a; Prolactin receptor; Prolactin receptor delta 7/11 ; RATPRLR; Secreted prolactin binding protein ; Truncated testis-specific box 1-C prolactin receptor ; wu:fj65c07

Gene Names: PRLR

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 25-622aa

Sequence Info: Full Length of Mature Protein

MW: 71.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: This is a receptor for the anterior pituitary hormone prolactin (PRL). Acts as a prosurvival factor for spermatozoa by inhibiting sperm capacitation through suppression of SRC kinase activation and stimulation of AKT. Isoform 4 is unable to transduce prolactin signaling. Isoform 6 is unable to transduce prolactin signaling.

Reference: "Alternative splicing to exon 11 of human prolactin receptor gene results in multiple isoforms including a secreted prolactin-binding protein." Trott J.F., Hovey R.C., Koduri S., Vonderhaar B.K. J. Mol. Endocrinol. 30:31-47(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This is a receptor for the anterior pituitary hormone prolactin (PRL). Acts as a prosurvival factor for spermatozoa by inhibiting sperm capacitation through suppression of SRC kinase activation and stimulation of AKT. Isoform 4 is unable to transduce prolactin signaling. Isoform 6 is unable to transduce prolactin signaling.

Involvement in disease: Multiple fibroadenomas of the breast (MFAB); Hyperprolactinemia (HPRL)

Subcellular Location: Membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 7: Secreted

Protein Families: Type I cytokine receptor family, Type 1 subfamily

Tissue Specificity: Expressed in breast, placenta, kidney, liver and pancreas.

Paythway: Jak-STATsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P16471

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose