Recombinant Human Proheparin-binding EGF-like growth factor (HBEGF), partial | CSB-YP857429HU

Recombinant Human Proheparin-binding EGF-like growth factor (HBEGF), partial | CSB-YP857429HU | Cusabio

Alternative Name(s): Diphtheria toxin receptor Short name:DT-R DTR, DTS, HEGFL

Gene Names: HBEGF

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Source: Yeast

Tag Info: C-terminal 6xHis-tagged

Expression Region: 63-148aa

Sequence Info: Partial

MW: 11.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.

Reference: "A heparin-binding growth factor secreted by macrophage-like cells that is related to EGF." Higashiyama S., Abraham J.A., Miller J., Fiddes J.C., Klagsbrun M. Science 251:936-939(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.

Involvement in disease:

Subcellular Location: Heparin-binding EGF-like growth factor: Secreted, extracellular space

Protein Families:

Tissue Specificity:

Paythway: ErbBsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99075

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM