Recombinant Human Programmed cell death 1 ligand 2 (PDCD1LG2), partial | CSB-EP017667HU

Recombinant Human Programmed cell death 1 ligand 2 (PDCD1LG2), partial | CSB-EP017667HU | Cusabio

Alternative Name(s): Butyrophilin B7-DC (B7-DC) (CD_antigen: CD273) (B7DC) (CD273) (PDCD1L2) (PDL2)

Gene Names: PDCD1LG2

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 21-118aa

Sequence Info: Partial

MW: 15.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production

Reference: "B7-DC, a new dendritic cell molecule with potent costimulatory properties for T cells." Tseng S.-Y., Otsuji M., Gorski K., Huang X., Slansky J.E., Pai S.I., Shalabi A., Shin T., Pardoll D.M., Tsuchiya H. J. Exp. Med. 193:839-846(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).

Involvement in disease:

Subcellular Location: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 2: Endomembrane system, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 1: Cell membrane, Single-pass type I membrane protein

Protein Families: Immunoglobulin superfamily, BTN/MOG family

Tissue Specificity: Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BQ51

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM