Recombinant Human Phytanoyl-CoA dioxygenase, peroxisomal (PHYH) | CSB-EP017946HU

Recombinant Human Phytanoyl-CoA dioxygenase, peroxisomal (PHYH) | CSB-EP017946HU | Cusabio

Alternative Name(s): Phytanic acid oxidase Phytanoyl-CoA alpha-hydroxylase

Gene Names: PHYH

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-338aa

Sequence Info: Full Length

MW: 62.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.

Reference: "Identification of PAHX, a Refsum disease gene." Mihalik S.J., Morrell J.C., Kim D., Sachsteder K.A., Watkins P.A., Gould S.J. Nat. Genet. 17:185-189(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.

Involvement in disease: Refsum disease (RD)

Subcellular Location: Peroxisome

Protein Families: PhyH family

Tissue Specificity: Expressed in liver, kidney, and T-cells, but not in spleen, brain, heart, lung and skeletal muscle.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O14832

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM