Recombinant Human Novel Coronavirus Spike glycoprotein (S) (K417N), partial | CSB-MP3324GMY1 (M7)h8

(No reviews yet) Write a Review
SKU:
CSB-MP3324GMY1 (M7)h8
Availability:
3 - 7 Working Days
£89.60 - £2,420.00

Description

Recombinant Human Novel Coronavirus Spike glycoprotein (S) (K417N), partial | CSB-MP3324GMY1 (M7)h8 | Cusabio

Target Name: S

Uniprot No: P0DTC2

Species: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Source: Mammalian cell

Tag Info: C-terminal mFc-tagged

Expression Region: 319-541aa (K417N)

Sequence Description: Partial (S1-RBD)

Target Protein Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Mol. Weight: 54.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Biological Activity: N/A

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

View AllClose

0 Reviews

View AllClose