Cusabio Covid-19 Recombinants
Recombinant Human Novel Coronavirus Spike glycoprotein (S) (K417N), partial | CSB-MP3324GMY1 (M7)h8
- SKU:
- CSB-MP3324GMY1 (M7)h8
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Novel Coronavirus Spike glycoprotein (S) (K417N), partial | CSB-MP3324GMY1 (M7)h8 | Cusabio
Target Name: S
Uniprot No: P0DTC2
Species: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Source: Mammalian cell
Tag Info: C-terminal mFc-tagged
Expression Region: 319-541aa (K417N)
Sequence Description: Partial (S1-RBD)
Target Protein Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Mol. Weight: 54.4 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
Biological Activity: N/A
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.