Recombinant Human Neurotrypsin (PRSS12) , partial | CSB-EP018812HU

(No reviews yet) Write a Review
SKU:
CSB-EP018812HU
Availability:
3 - 7 Working Days
  • Recombinant Human Neurotrypsin (PRSS12) , partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Human Neurotrypsin (PRSS12) , partial | CSB-EP018812HU | Cusabio

Alternative Name(s): Leydin Motopsin Serine protease 12

Gene Names: PRSS12

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: IIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 631-874aa

Sequence Info: Partial

MW: 43.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a role in neuronal plasticity and the proteolytic action may subserve structural reorganizations associated with learning and memory operations.

Reference: "Cloning and sequencing of the cDNA encoding human neurotrypsin."Proba K., Gschwend T.P., Sonderegger P.Biochim. Biophys. Acta 1396:143-147(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a role in neuronal plasticity and the proteolytic action may subserve structural reorganizations associated with learning and memory operations.

Involvement in disease: Mental retardation, autosomal recessive 1 (MRT1)

Subcellular Location: Secreted

Protein Families: Peptidase S1 family

Tissue Specificity: Brain and Leydig cells of the testis.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P56730

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose