Recombinant Human Neurofascin (NFASC), partial | CSB-EP015743HU

Recombinant Human Neurofascin (NFASC), partial | CSB-EP015743HU | Cusabio

Alternative Name(s): KIAA0756; Neurofascin; Neurofascin homolog; NF; Nfasc; NFASC_HUMAN; NRCAML

Gene Names: NFASC

Research Areas: Cell Adhesion

Organism: Homo sapiens (Human)

AA Sequence: KRSRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEGNESSEATSPVNAIYSLA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1239-1347aa

Sequence Info: Cytoplasmic Domain

MW: 15.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cell adhesion, ankyrin-binding protein which may be involved in neurite extension, axonal guidance, synaptogenesis, myelination and neuron-glial cell interactions.

Reference: Myocilin mediates myelination in the peripheral nervous system through ErbB2/3 signaling.Kwon H.S., Johnson T.V., Joe M.K., Abu-Asab M., Zhang J., Chan C.C., Tomarev S.I.J. Biol. Chem. 288:26357-26371(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cell adhesion, ankyrin-binding protein which may be involved in neurite extension, axonal guidance, synaptogenesis, myelination and neuron-glial cell interactions.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families: Immunoglobulin superfamily, L1/neurofascin/NgCAM family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O94856

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM