Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 (NDUFB10) | CSB-EP015642HU

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 (NDUFB10) | CSB-EP015642HU | Cusabio

Alternative Name(s): Complex I-PDSW

Gene Names: NDUFB10

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-172aa

Sequence Info: Full Length

MW: 47.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Reference: "One subunit of human NADH-ubiquinone oxidoreductase, hPDSW, located at 16p13.3 and down-regulated in a prostate cell line." Wang L., Zhang J., Smith D.I. Submitted (AUG-1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Involvement in disease:

Subcellular Location: Mitochondrion inner membrane, Peripheral membrane protein, Matrix side

Protein Families: Complex I NDUFB10 subunit family

Tissue Specificity:

Paythway: OxidativePhosphorylation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O96000

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM