Cusabio Human Recombinants
Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 (NDUFB10) | CSB-EP015642HU
- SKU:
- CSB-EP015642HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 (NDUFB10) | CSB-EP015642HU | Cusabio
Alternative Name(s): Complex I-PDSW
Gene Names: NDUFB10
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-172aa
Sequence Info: Full Length
MW: 47.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Reference: "One subunit of human NADH-ubiquinone oxidoreductase, hPDSW, located at 16p13.3 and down-regulated in a prostate cell line." Wang L., Zhang J., Smith D.I. Submitted (AUG-1998)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Involvement in disease:
Subcellular Location: Mitochondrion inner membrane, Peripheral membrane protein, Matrix side
Protein Families: Complex I NDUFB10 subunit family
Tissue Specificity:
Paythway: OxidativePhosphorylation
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O96000
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM