Recombinant Human Myosin light chain 1/3, skeletal muscle isoform (MYL1) | CSB-EP015305HU

(No reviews yet) Write a Review
SKU:
CSB-EP015305HU
Availability:
13 - 23 Working Days
  • Recombinant Human Myosin light chain 1/3, skeletal muscle isoform (MYL1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Myosin light chain 1/3, skeletal muscle isoform (MYL1) | CSB-EP015305HU | Cusabio

Alternative Name(s): Myosin light chain alkali 1/2

Gene Names: MYL1

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-150aa

Sequence Info: Full Length of Isoform MLC3

MW: 43.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Regulatory light chain of myosin. Does not bind calcium.

Reference: "Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms." Seidel U., Bober E., Winter B., Lenz S., Lohse P., Goedde H., Grzeschik K., Arnold H.H. Gene 66:135-146(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Regulatory light chain of myosin. Does not bind calcium.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P05976

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose