Cusabio Human Recombinants
Recombinant Human Myosin light chain 1/3, skeletal muscle isoform (MYL1) | CSB-EP015305HU
- SKU:
- CSB-EP015305HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Myosin light chain 1/3, skeletal muscle isoform (MYL1) | CSB-EP015305HU | Cusabio
Alternative Name(s): Myosin light chain alkali 1/2
Gene Names: MYL1
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-150aa
Sequence Info: Full Length of Isoform MLC3
MW: 43.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Regulatory light chain of myosin. Does not bind calcium.
Reference: "Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms." Seidel U., Bober E., Winter B., Lenz S., Lohse P., Goedde H., Grzeschik K., Arnold H.H. Gene 66:135-146(1988)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Regulatory light chain of myosin. Does not bind calcium.
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P05976
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM