null

Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial (Active) | CSB-MP004925HU

(No reviews yet) Write a Review
SKU:
CSB-MP004925HU
Availability:
3 to 7 Working Days
  • Recombinant Human Myeloid cell surface antigen CD33 (CD33) ,partial (Active)
  • Recombinant Human Myeloid cell surface antigen CD33 (CD33) ,partial (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€170.00 - €254.00
Frequently bought together:

Description

Recombinant Human Myeloid cell surface antigen CD33 (CD33) ,partial (Active) | CSB-MP004925HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Sialic acid-binding Ig-like lectin 3 (Siglec-3) (gp67) (CD33) (SIGLEC3)

Gene Names: CD33

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal hFc-Myc-tagged

Expression Region: 18-259aa

Sequence Info: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 μg/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC50 of human CD33 protein is 4.289- 5.312 ng/ml.

MW: 56.9 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance: Sialic-acid-binding immunoglobulin-like lectin that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state . Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans . Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK . These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 . In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules . One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K .

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P20138

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose