Cusabio Human Recombinants
Recombinant Human Metalloproteinase inhibitor 4 (TIMP4), partial | CSB-RP074194h
- SKU:
- CSB-RP074194h
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Metalloproteinase inhibitor 4 (TIMP4), partial | CSB-RP074194h | Cusabio
Alternative Name(s): Tissue inhibitor of metalloproteinases 4 ;TIMP-4
Gene Names: TIMP4
Research Areas: Cardiovascular
Organism: Homo sapiens (Human)
AA Sequence: SCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 31-224aa
Sequence Info: Partial
MW: 26.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.
Reference: Molecular cloning and characterization of human tissue inhibitor of metalloproteinase 4.Greene J., Wang M., Liu Y.E., Raymond L.A., Rosen C., Shi Y.E.J. Biol. Chem. 271:30375-30380(1996)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Protease inhibitor I35 (TIMP) family
Tissue Specificity: Abundant in heart and present at low levels in many other tissues.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q99727
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM