Recombinant Human Metalloproteinase inhibitor 4 (TIMP4) | CSB-YP857872HU

(No reviews yet) Write a Review
SKU:
CSB-YP857872HU
Availability:
25 - 35 Working Days
  • Recombinant Human Metalloproteinase inhibitor 4 (TIMP4)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€339.00 - €1,345.00

Description

Recombinant Human Metalloproteinase inhibitor 4 (TIMP4) | CSB-YP857872HU | Cusabio

Alternative Name(s): Tissue inhibitor of metalloproteinases 4 ;TIMP-4

Gene Names: TIMP-4

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: CSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 30-224aa

Sequence Info: Full Length of Mature Protein

MW: 24.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.

Reference: Molecular cloning and characterization of human tissue inhibitor of metalloproteinase 4.Greene J., Wang M., Liu Y.E., Raymond L.A., Rosen C., Shi Y.E.J. Biol. Chem. 271:30375-30380(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Protease inhibitor I35 (TIMP) family

Tissue Specificity: Abundant in heart and present at low levels in many other tissues.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99727

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose