Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active) | CSB-MP004940HU

(No reviews yet) Write a Review
SKU:
CSB-MP004940HU
Availability:
3 to 7 Working Days
  • Recombinant Human Leukocyte surface antigen CD47 (CD47) ,partial (Active)
  • Recombinant Human Leukocyte surface antigen CD47 (CD47) ,partial (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£146.40 - £224.00

Description

Recombinant Human Leukocyte surface antigen CD47 (CD47) ,partial (Active) | CSB-MP004940HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Antigenic surface determinant protein OA3(Integrin-associated protein)(IAP)(Protein MER6)(CD47)

Gene Names: CD47

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal hFc-tagged

Expression Region: 19-139aa

Sequence Info: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized SIRPA (CSB-MP021334HU) at 2 μg/ml can bind human CD47, the EC50 of human CD47 protein is 65.91-82.42 ng/ml. ②Human SIRPA protein His/Myc tag (CSB-MP021334HU) captured on COOH chip can bind Human CD47 protein Fc tag (CSB-MP004940HU) with an affinity constant of 19.1 nM as detected by LSPR Assay.

MW: 41.5 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance: Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q08722

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose