null

Recombinant Human IGFL1 (Active)

(No reviews yet) Write a Review
SKU:
CSB-MP764932HU
Availability:
3 to 7 Working Days
  • Recombinant Human IGFL1 - VLPs (Active)
  • Recombinant Human IGFL1 - VLPs (Active)
  • Recombinant Human IGFL1 - VLPs (Active)
€306.00 - €436.00
Frequently bought together:

Description

Recombinant Human Insulin growth factor-like family member 1(IGFL1) (Active) | CBS-MP003996HU | Cusabio.

Recombinant human IGFL1 protein is produced by a mammalian expression system. The target protein is expressed with a DNA fragment (Ala25-Ser110) of human IGFL1 fused with a hFc tag at the C-terminus. This active IGFL1 protein has been measured its activity in a functional ELISA. Immobilized human IGFLR1 binds to this IGFL1 protein with EC50 of 32.33-47.52 ng/mL. The SDS-PAGE showed that the purity of this IGFL1 protein was greater than 95%. The IGFL1 protein has an apparent molecular weight of approximately 40 kDa due to glycosylation. The LAL method showed that the protein contained endotoxin less than 1.0 EU/ug. This human IGFL1 protein is in stock now.

IGFL1 is expressed in cancer cell lines, fetal skin, head and neck tumors, normal breast, squamous cell carcinoma, and uterine tumors. IGFL1 expression is up-regulated in human psoriasis skin. Studies showed that human IGFL1 produced may regulate T cell response. Xiaorong Ji et al. found that high IGFL1 expression can be used as an independent prognostic factor of serous ovarian carcinoma.

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 (CSB-MP862025HU) at 2 μg/mL can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL.

Target Names: IGFL1

Uniprot No. Q6UW32

Research Area: other

Molecular Characterization:

Species: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 25-110aa

Target Protein Sequence: APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

Mol. Weight: 38.7 kDa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal hFc-tagged

Form: Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage Condition: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time: Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA: Please contact us to get it.

 

 

 

View AllClose

0 Reviews

View AllClose