null

Recombinant Human Inhibin beta C chain (INHBC) (Active) | CSB-AP005431HU

(No reviews yet) Write a Review
SKU:
CSB-AP005431HU
Availability:
5 to 10 Working Days
  • Recombinant Human Inhibin beta C chain (INHBC) (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€288.00 - €652.00
Frequently bought together:

Description

Recombinant Human Inhibin beta C chain (INHBC) (Active) | CSB-AP005431HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : Inhibin Beta C Chain; Activin Beta-C Chain; INHBC

Gene Names: INHBC

Research Areas: Signal Transduction

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 237-352aa

Sequence Info: GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Biological Activity: The ED50 as determined by its ability to bind Human Activin RIIA in functional ELISA is less than 20 ug/ml.

MW: 14.83 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins,Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: TGF-beta family

Tissue Specificity: Expressed in benign prostatic hyperplasia.

Paythway: TGF-betasignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm Filtered 4 mM HCl, 1 mM DTT

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55103

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose