Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1) | CSB-EP010706HU

(No reviews yet) Write a Review
SKU:
CSB-EP010706HU
Availability:
13 - 23 Working Days
  • Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP158274h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HPRT1.
£196.00 - £1,021.60

Description

Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1) | CSB-EP010706HU | Cusabio

Alternative Name(s): /

Gene Names: HPRT1

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-218aa

Sequence Info: Full Length of Mature Protein

MW: 28.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.

Reference: Isolation and characterization of a full-length expressible cDNA for human hypoxanthine phosphoribosyl transferase.Jolly D.J., Okayama H., Berg P., Esty A.C., Filpula D., Bohlen P., Johnson G.G., Shively J.E., Hunkapillar T., Friedmann T.Proc. Natl. Acad. Sci. U.S.A. 80:477-481(1983)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.

Involvement in disease: Lesch-Nyhan syndrome (LNS); Gout HPRT-related (GOUT-HPRT)

Subcellular Location: Cytoplasm

Protein Families: Purine/pyrimidine phosphoribosyltransferase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P00492

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose