Recombinant Human Homeobox protein Hox-A2 (HOXA2), partial | CSB-YP010652HU

(No reviews yet) Write a Review
SKU:
CSB-YP010652HU
Availability:
25 - 35 Working Days
£306.40 - £1,618.40

Description

Recombinant Human Homeobox protein Hox-A2 (HOXA2), partial | CSB-YP010652HU | Cusabio

Alternative Name(s): Homeobox protein Hox-1K (HOX1K)

Gene Names: HOXA2

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: PPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAGGRPKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGP

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 26-124aa

Sequence Info: Partial

MW: 12

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Reference: "HOXA2 haploinsufficiency in dominant bilateral microtia and hearing loss." Brown K.K., Viana L.M., Helwig C.C., Artunduaga M.A., Quintanilla-Dieck L., Jarrin P., Osorno G., McDonough B., Depalma S.R., Eavey R.D., Seidman J.G., Seidman C.E. Hum. Mutat. 34:1347-1351(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O43364

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose