Cusabio Human Recombinants
Recombinant Human Homeobox protein Hox-A2 (HOXA2), partial | CSB-YP010652HU
- SKU:
- CSB-YP010652HU
- Availability:
- 25 - 35 Working Days
Description
Recombinant Human Homeobox protein Hox-A2 (HOXA2), partial | CSB-YP010652HU | Cusabio
Alternative Name(s): Homeobox protein Hox-1K (HOX1K)
Gene Names: HOXA2
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: PPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAGGRPKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGP
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 26-124aa
Sequence Info: Partial
MW: 12
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Reference: "HOXA2 haploinsufficiency in dominant bilateral microtia and hearing loss." Brown K.K., Viana L.M., Helwig C.C., Artunduaga M.A., Quintanilla-Dieck L., Jarrin P., Osorno G., McDonough B., Depalma S.R., Eavey R.D., Seidman J.G., Seidman C.E. Hum. Mutat. 34:1347-1351(2013)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O43364
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A