Recombinant Human HLA class I histocompatibility antigen, alpha chain E (HLA-E) , partial | CSB-EP320269HU

Recombinant Human HLA class I histocompatibility antigen, alpha chain E (HLA-E) , partial | CSB-EP320269HU | Cusabio

Alternative Name(s): MHC class I antigen E

Gene Names: HLA-E

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-305aa

Sequence Info: Extracellular Domain

MW: 48.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.

Reference: Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families: MHC class I family

Tissue Specificity:

Paythway: Cellularsenescence

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P13747

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM