Cusabio Human Recombinants
Recombinant Human HLA class I histocompatibility antigen, A-1 alpha chain (HLA-A), partial | CSB-EP328989HU
- SKU:
- CSB-EP328989HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human HLA class I histocompatibility antigen, A-1 alpha chain (HLA-A), partial | CSB-EP328989HU | Cusabio
Alternative Name(s): MHC class I antigen A*1 HLAA
Gene Names: HLA-A
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 25-308aa
Sequence Info: Extracellular Domain
MW: 36.7 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Involved in the presentation of foreign antigens to the immune system.
Reference: "A generic sequencing based typing approach for the identification of HLA-A diversity." Sitha S., Scheltinga S.A., Johnston-Dow L.A., White C.B., der van Zwan A.W., Bakema J.E., Rozemuller E.H., van der Tweel J.G., Kronink M.N., Tilanus M.G.J. Hum. Immunol. 57:120-128(1997)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Involved in the presentation of foreign antigens to the immune system.
Involvement in disease:
Subcellular Location: Membrane, Single-pass type I membrane protein
Protein Families: MHC class I family
Tissue Specificity:
Paythway: Cellularsenescence
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P30443
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: OMIM