Recombinant Human HLA class I histocompatibility antigen, A-1 alpha chain (HLA-A), partial | CSB-EP328989HU

(No reviews yet) Write a Review
SKU:
CSB-EP328989HU
Availability:
3 - 7 Working Days
  • Recombinant Human HLA class I histocompatibility antigen, A-1 alpha chain (HLA-A), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Human HLA class I histocompatibility antigen, A-1 alpha chain (HLA-A), partial | CSB-EP328989HU | Cusabio

Alternative Name(s): MHC class I antigen A*1 HLAA

Gene Names: HLA-A

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 25-308aa

Sequence Info: Extracellular Domain

MW: 36.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Involved in the presentation of foreign antigens to the immune system.

Reference: "A generic sequencing based typing approach for the identification of HLA-A diversity." Sitha S., Scheltinga S.A., Johnston-Dow L.A., White C.B., der van Zwan A.W., Bakema J.E., Rozemuller E.H., van der Tweel J.G., Kronink M.N., Tilanus M.G.J. Hum. Immunol. 57:120-128(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the presentation of foreign antigens to the immune system.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families: MHC class I family

Tissue Specificity:

Paythway: Cellularsenescence

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P30443

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose