Recombinant Human Heat shock 70KDA protein 13 (HSPA13) | CSB-RP109644h

(No reviews yet) Write a Review
SKU:
CSB-RP109644h
Availability:
13 - 23 Working Days
  • Recombinant Human Heat shock 70KDA protein 13 (HSPA13)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Heat shock 70KDA protein 13 (HSPA13) | CSB-RP109644h | Cusabio

Alternative Name(s): Microsomal stress-70 protein ATPase core;Stress-70 protein chaperone microsome-associated 60KDA protein

Gene Names: HSPA13

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: QQYLPLPTPKVIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVGYESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVTSNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNFN

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 23-471aa

Sequence Info: Full Length of Mature Protein

MW: 76.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has peptide-independent ATPase activity.

Reference: Stch encodes the 'ATPase core' of a microsomal stress 70 protein.Otterson G.A., Flynn G.C., Kratzke R.A., Coxon A., Johnston P.G., Kaye F.J.EMBO J. 13:1216-1225(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has peptide-independent ATPase activity.

Involvement in disease:

Subcellular Location: Microsome, Endoplasmic reticulum

Protein Families: Heat shock protein 70 family

Tissue Specificity: Constitutively expressed in all tissues.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P48723

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose