Cusabio Active Proteins
Recombinant Human Glutathione S-transferase kappa 1 (GSTK1), partial (Active) | CSB-EP009978HU
- SKU:
- CSB-EP009978HU
- Availability:
- 3 to 7 Working Days
Description
Recombinant Human Glutathione S-transferase kappa 1 (GSTK1) ,partial (Active) | CSB-EP009978HU | Cusabio
Protein Description: Partial
Alternative Name (s) : GST 13-13 GST class-kappa GSTK1-1
Gene Names: GSTK1
Research Areas: Tags & Cell Markers
Species: Homo sapiens (Human)
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 2-226aa
Sequence Info: GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized HTR1B at 5 μg/ml can bind human GSTK1,the EC50 of human GSTK1 protein is 159.40-218.50 ng/ml.
MW: 52.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test.
Relevance: Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB) .
PubMed ID:
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9Y2Q3
Uniprot Entry Name:
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A