Cusabio Human Recombinants
Recombinant Human Glutamyl-tRNA (Gln) amidotransferase subunit C, mitochondrial (GATC) | CSB-EP009283HU
- SKU:
 - CSB-EP009283HU
 - Availability:
 - 13 - 23 Working Days
 
Description
Recombinant Human Glutamyl-tRNA (Gln) amidotransferase subunit C, mitochondrial (GATC) | CSB-EP009283HU | Cusabio
Alternative Name(s): Protein 15E1.2
Gene Names: GATC
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-136aa
Sequence Info: Full Length
MW: 42.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Reference: "Biogenesis of glutaminyl-mt tRNAGln in human mitochondria." Nagao A., Suzuki T., Katoh T., Sakaguchi Y., Suzuki T. Proc. Natl. Acad. Sci. U.S.A. 106:16209-16214(2009)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Involvement in disease:
Subcellular Location: Mitochondrion
Protein Families: GatC family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O43716
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A