Recombinant Human Threonine--tRNA ligase, mitochondrial (TARS2), partial | CSB-EP023132HU

Recombinant Human Threonine--tRNA ligase, mitochondrial (TARS2), partial | CSB-EP023132HU | Cusabio

Alternative Name(s): Threonyl-tRNA synthetase ;ThrRSThreonyl-tRNA synthetase-like 1

Gene Names: TARS2

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: EHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 369-718aa

Sequence Info: Partial

MW: 55.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: VARS2 and TARS2 mutations in patients with mitochondrial encephalomyopathies.Diodato D., Melchionda L., Haack T.B., Dallabona C., Baruffini E., Donnini C., Granata T., Ragona F., Balestri P., Margollicci M., Lamantea E., Nasca A., Powell C.A., Minczuk M., Strom T.M., Meitinger T., Prokisch H., Lamperti C., Zeviani M., Ghezzi D.Hum. Mutat. 35:983-989(2014)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the attachment of threonine to tRNA(Thr) in a two-step reaction

Involvement in disease: Combined oxidative phosphorylation deficiency 21 (COXPD21)

Subcellular Location: Mitochondrion matrix

Protein Families: Class-II aminoacyl-tRNA synthetase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BW92

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM