Recombinant Human Galectin-7 (LGALS7) | CSB-EP012892HU

Recombinant Human Galectin-7 (LGALS7) | CSB-EP012892HU | Cusabio

Alternative Name(s): HKL-14PI7p53-induced gene 1 protein

Gene Names: LGALS7

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-136aa

Sequence Info: Full Length of Mature Protein

MW: 18.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.

Reference: Cloning, expression, and chromosome mapping of human galectin-7.Madsen P., Rasmussen H.H., Flint T., Gromov P., Kruse T.A., Honore B., Vorum H., Celis J.E.J. Biol. Chem. 270:5823-5829(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus, Secreted

Protein Families:

Tissue Specificity: Mainly expressed in stratified squamous epithelium.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P47929

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM