null

Recombinant Mouse Galectin-7 (Lgals7) | CSB-EP012892MO

(No reviews yet) Write a Review
SKU:
CSB-EP012892MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Galectin-7 (Lgals7)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00
Frequently bought together:

Description

Recombinant Mouse Galectin-7 (Lgals7) | CSB-EP012892MO | Cusabio

Alternative Name(s): Lgals7; Galectin-7; Gal-7

Gene Names: Lgals7

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-136aa

Sequence Info: Full Length of Mature Protein

MW: 19 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release .

Reference: Galectin-7, a marker of all types of stratified epithelia.Magnaldo T., Fowlis D., Darmon M.Differentiation 63:159-168(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release (By similarity).

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus, Secreted

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O54974

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose