Recombinant Human Fractalkine (CX3CL1), partial | CSB-EP006235HU(F)

Recombinant Human Fractalkine (CX3CL1), partial | CSB-EP006235HU(F) | Cusabio

Alternative Name(s): C-X3-C motif chemokine 1CX3C membrane-anchored chemokineNeurotactin;Small-inducible cytokine D1

Gene Names: CX3CL1

Research Areas: Cell Adhesion

Organism: Homo sapiens (Human)

AA Sequence: QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 25-100aa

Sequence Info: Partial

MW: 24.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: The soluble form is chotactic for T-cells and monocytes, but not for neutrophils. The mbrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1.

Reference: Structural basis of chemokine sequestration by CrmD, a poxvirus-encoded tumor necrosis factor receptor.Xue X., Lu Q., Wei H., Wang D., Chen D., He G., Huang L., Wang H., Wang X.PLoS Pathog. 7:E1002162-E1002162(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Acts as a ligand for both CX3CR1 and integrins. Binds to CX3CR1

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Processed fractalkine: Secreted

Protein Families: Intercrine delta family

Tissue Specificity: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas. Most abundant in the brain and heart.

Paythway: Chemokinesignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P78423

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM