Recombinant Human Folate receptor beta (FOLR2), partial | CSB-BP008786HU1

(No reviews yet) Write a Review
SKU:
CSB-BP008786HU1
Availability:
3 - 7 Working Days
  • Recombinant Human Folate receptor beta (FOLR2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$393.60 - $888.00

Description

Recombinant Human Folate receptor beta (FOLR2), partial | CSB-BP008786HU1 | Cusabio

Alternative Name(s): Folate receptor 2 Folate receptor, fetal/placental Placental folate-binding protein

Gene Names: FOLR2

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged

Expression Region: 19-230aa

Sequence Info: Partial

MW: 27.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.

Reference: "Folate coenzyme and antifolate transport proteins in normal and neoplastic cells." Freisheim J.H., Price E.M., Ratnam M. Adv. Enzyme Regul. 29:13-26(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor, Secreted

Protein Families: Folate receptor family

Tissue Specificity: Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues.

Paythway: Endocytosis

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P14207

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose