null

Recombinant Human Beta-1 adrenergic receptor (ADRB1), partial | CSB-YP001391HU

(No reviews yet) Write a Review
SKU:
CSB-YP001391HU
Availability:
25 - 35 Working Days
  • Recombinant Human Beta-1 adrenergic receptor (ADRB1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€339.00 - €1,345.00
Frequently bought together:

Description

Recombinant Human Beta-1 adrenergic receptor (ADRB1), partial | CSB-YP001391HU | Cusabio

Alternative Name(s): Beta-1 adrenoreceptor Short name: Beta-1 adrenoceptor

Gene Names: ADRB1

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 378-477aa

Sequence Info: Cytoplasmic Domain

MW: 12.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.

Reference: "Interaction with cystic fibrosis transmembrane conductance regulator-associated ligand (CAL) inhibits beta1-adrenergic receptor surface expression."He J., Bellini M., Xu J., Castleberry A.M., Hall R.A.J. Biol. Chem. 279:50190-50196(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein, Early endosome

Protein Families: G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily

Tissue Specificity:

Paythway: Calciumsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P08588

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose